PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.17G066600.1.p
Common NameCOL8, GLYMA_17G066600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family CO-like
Protein Properties Length: 375aa    MW: 40706.6 Da    PI: 6.3058
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.17G066600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.45.1e-072060438
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                         + C+ ++   + lfC+ ++ +lC  C +++H +      H+
  Glyma.17G066600.1.p 20 KPCDSCKLASAALFCRPDSAFLCIACDSNIHCSnklasrHE 60
                         68******99*********************7656777776 PP

2zf-B_box27.75.4e-0962107342
             zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                           ++C+ +e+ ++   C+ +   lC +C + +H+       H++vp+
  Glyma.17G066600.1.p  62 VWMCEVCEQAPAAVTCKADAAALCVTCDSDIHSAnplaqrHERVPV 107
                          689*****************************66899999999986 PP

3CCT69.77.5e-24302345144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Glyma.17G066600.1.p 302 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 345
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.0681764IPR000315B-box-type zinc finger
SMARTSM003364.7E-91764IPR000315B-box-type zinc finger
CDDcd000212.32E-72164No hitNo description
PROSITE profilePS5011910.80860107IPR000315B-box-type zinc finger
PfamPF006436.4E-762107IPR000315B-box-type zinc finger
CDDcd000215.87E-963107No hitNo description
SMARTSM003366.0E-1065107IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787302344IPR010402CCT domain
PfamPF062035.8E-18302344IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MGIERGGFKG FRSAWSVPPK PCDSCKLASA ALFCRPDSAF LCIACDSNIH CSNKLASRHE  60
RVWMCEVCEQ APAAVTCKAD AAALCVTCDS DIHSANPLAQ RHERVPVEPF FDSAESIVKA  120
SAAATFGFIV PSDDGGASDA FAPDDSDAAA WLIPNPNFGS KLMDAPEIKS KEIFFSEMDP  180
FLDFDYSNSF QNNNSAGNDS VVPVQKPSLA PPLINNHHHH QSETCFDVDF CRSKLSSFNY  240
PSNSLSQSVS SSSLDVGVVP DGNTVSDMSY SFGRNSSDSS GIVVVSGNSV GQGATQLCGM  300
DREARVLRYR EKRKNRKFEK TIRYASRKAY AETRPRIKGR FAKRTEIDSD VERLYSPGPA  360
VLMLDTPYGV VPSF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.20100.0cotyledon| flower| leaf| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGQ8642620.0GQ864262.1 Glycine max CONSTANS-like zinc finger protein (COL8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001239972.10.0zinc finger protein CONSTANS-LIKE 5-like
SwissprotQ9FHH81e-122COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLD0EP030.0D0EP03_SOYBN; CONSTANS-like zinc finger protein
STRINGGLYMA17G07420.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13023493
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-108CONSTANS-like 5